PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034106t1
Common NameTCM_034106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 161aa    MW: 18259.2 Da    PI: 6.1086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034106t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.84.1e-123290563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+++NRe+ArrsR RK++ ++ L   v +L + N +    ++  ++++ + ++e+
  Thecc1EG034106t1 32 RKRKRMESNRESARRSRMRKQKHLDDLVSQVTQLRKDNNQILTSINFTTQHYLNIEAEN 90
                      6789***********************************99999998888888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-172892IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1030107No hitNo description
PROSITE profilePS5021710.3923093IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-123285No hitNo description
PfamPF001701.6E-93283IPR004827Basic-leucine zipper domain
CDDcd147024.18E-193383No hitNo description
PROSITE patternPS0003603550IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MASSSGNSNS SGSTLLQNSG SEEDLQHLMD QRKRKRMESN RESARRSRMR KQKHLDDLVS  60
QVTQLRKDNN QILTSINFTT QHYLNIEAEN SVLRAQMMEL SQRLESLSEI LDYLNSTTTN  120
GGLYETHQGF ETSSADSFTN PFNLPYLNQP IMASADIFQY *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13152RKRKRMESNRESARRSRMRKQK
24451RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017624.11e-114Basic leucine-zipper 44
TrEMBLA0A061FK201e-114A0A061FK20_THECC; Basic leucine-zipper 44
STRINGPOPTR_0005s25290.15e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.16e-54basic leucine-zipper 44
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]